(data stored in ACNUC1104 zone)

EMBL: FN667742.HFLX

FN667742.HFLX        Location/Qualifiers
FT   CDS             389804..391084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0083"
FT                   /gene="hflX"
FT                   /locus_tag="XNC1_0456"
FT                   /product="putative GTPase subunit of protease with
FT                   nucleoside triP hydrolase domain, together with HflC-HflK
FT                   involved in stability of phage lambda cII repressor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88530"
FT                   /db_xref="GOA:D3VII0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D3VII0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88530.1"
FT                   /translation="MFDRYEGGELAVLVHVFFSQEKDTENLSEFESLVTSAGVSPVQIV
FT                   TGSRKAPHPKYFVGEGKAEEIAEAVKNSGADVVLFNHTLSPAQERNLERLCQCRVVDRT
FT                   GVILDIFAQRARTHEGKLQVELAQLRHLSTRLVRGWTHLERQKGGIGLRGPGETQLESD
FT                   RRMLRDKIKQILGRLSKVEKQREQGRQARNKADIPTVSLVGYTNAGKSSLFNSITSAKV
FT                   YAADQLFATLDPTLRRIDVDDVGTVVLADTVGFIRHLPHDLVAAFKATLQETRQAKLLL
FT                   HVVDAADHRLDENIIAVDSVLEEIESNEIPSLMVMNKIDMLEDFTPRIDRDEENRPVRV
FT                   WLSAQTGEGISLLLQALTERLSGETAHYELHLPPEAGRLRSRFYQLQAIEREWMEEDGQ
FT                   VGLEVRMPMVDWRRLCKQEPNLPDYVV"
     MFDRYEGGEL AVLVHVFFSQ EKDTENLSEF ESLVTSAGVS PVQIVTGSRK APHPKYFVGE        60
     GKAEEIAEAV KNSGADVVLF NHTLSPAQER NLERLCQCRV VDRTGVILDI FAQRARTHEG       120
     KLQVELAQLR HLSTRLVRGW THLERQKGGI GLRGPGETQL ESDRRMLRDK IKQILGRLSK       180
     VEKQREQGRQ ARNKADIPTV SLVGYTNAGK SSLFNSITSA KVYAADQLFA TLDPTLRRID       240
     VDDVGTVVLA DTVGFIRHLP HDLVAAFKAT LQETRQAKLL LHVVDAADHR LDENIIAVDS       300
     VLEEIESNEI PSLMVMNKID MLEDFTPRID RDEENRPVRV WLSAQTGEGI SLLLQALTER       360
     LSGETAHYEL HLPPEAGRLR SRFYQLQAIE REWMEEDGQV GLEVRMPMVD WRRLCKQEPN       420
     LPDYVV                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page