(data stored in ACNUC1104 zone)

EMBL: FN667742.HSDR

FN667742.HSDR        Location/Qualifiers
FT   CDS             complement(16057..19146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /gene="hsdR"
FT                   /locus_tag="XNC1_0018"
FT                   /product="Type I site-specific deoxyribonuclease HsdR"
FT                   /EC_number="3.1.21.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8566812; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88111"
FT                   /db_xref="GOA:D3VG21"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88111.1"
FT                   /translation="MSTVGQRERVTQDRIVKFFQTELGYRYLGNLQDRDNKNIDVDILT
FT                   AWLKKQGISGTLIGRVLRQLINTAALGDGNKLYYANKDVYNLLRYGIKEKEDVGEQHQT
FT                   IWLINWHNPEANDFAIAEEVSIKGENKKRPDIVLYVNGIALGIIELKRSSVSVSEGIRQ
FT                   NLDNQKKEFIRDFFSTMQLVMAGNDTQGLRYGTIGTPEKYYLEWKEGIDNPYPYRLDFH
FT                   LSRICSKPRFLQLIHDFIVFDAGVKKACRHNQFFGVEAAKKRIFQREGGIIWHTQGSGK
FT                   SLTMVWLAKWIRENVPNSRVLIVTDRTELDAQIEKVFTGVEENIYRTKSGADLIFNLNR
FT                   PNPWLICSLVHKFGHRSEAEDDAATDEYIKELKKSLPSDFRAKGDLFVFVDECHRTQSG
FT                   KLHDAMKSILPEAVFIGFTGTPLMKKDKKKSIEVFGSFIHTYKFDEAVSDGVILDLRYE
FT                   ARDIDQYLTSQKRIDEWFEANTQGLSRLGKTQLKQKWGTMQKVLSSKSRLEMIVMDIRL
FT                   DMMKRPRLMDGRGNAMLVCSSIHQACTVYDLFSQTDLAGKVAIITSYKPDSASIKGEET
FT                   GEGLTEQLAKYKTYRKMLADYFEQPEDKVANRVEEFETKVKQQFIDEPGQMRLLIVVDK
FT                   LLTGFDAPSATYLYIDKHMSDHNLFQAICRVNRLDGDDKEYGYIIDYKDLFRSLNKAIS
FT                   DYTKEVFDGYDKKDIDGLLKNRLEQARLNLDAALEMVRALCEPVKAPRNTVDYIHYFCC
FT                   ESGADPELLSEKEALRLALYQCVAKLLRAFANIANEMTIAGYSPAQMEKIRAEVAHYEK
FT                   VRDEIKLASKDKVEMKRYEPAMRSLIDMYIRADDSEVLMDFEEIGLLELIIQKGAAAGE
FT                   DLPEGIRKDPEAMAETIENNVRKTIVDENPVNPRYYEHMSVLLDELIALRRQNALNYQE
FT                   YLEKIRDLAKKVVRPNQNTAAYPPDIDTPPKRAFYDNFDQNTDLAICIDKTIRDTKKAD
FT                   WVNDRFKEREIANALRDETAEYKVDIDKIMELAKTQRDYR"
     MSTVGQRERV TQDRIVKFFQ TELGYRYLGN LQDRDNKNID VDILTAWLKK QGISGTLIGR        60
     VLRQLINTAA LGDGNKLYYA NKDVYNLLRY GIKEKEDVGE QHQTIWLINW HNPEANDFAI       120
     AEEVSIKGEN KKRPDIVLYV NGIALGIIEL KRSSVSVSEG IRQNLDNQKK EFIRDFFSTM       180
     QLVMAGNDTQ GLRYGTIGTP EKYYLEWKEG IDNPYPYRLD FHLSRICSKP RFLQLIHDFI       240
     VFDAGVKKAC RHNQFFGVEA AKKRIFQREG GIIWHTQGSG KSLTMVWLAK WIRENVPNSR       300
     VLIVTDRTEL DAQIEKVFTG VEENIYRTKS GADLIFNLNR PNPWLICSLV HKFGHRSEAE       360
     DDAATDEYIK ELKKSLPSDF RAKGDLFVFV DECHRTQSGK LHDAMKSILP EAVFIGFTGT       420
     PLMKKDKKKS IEVFGSFIHT YKFDEAVSDG VILDLRYEAR DIDQYLTSQK RIDEWFEANT       480
     QGLSRLGKTQ LKQKWGTMQK VLSSKSRLEM IVMDIRLDMM KRPRLMDGRG NAMLVCSSIH       540
     QACTVYDLFS QTDLAGKVAI ITSYKPDSAS IKGEETGEGL TEQLAKYKTY RKMLADYFEQ       600
     PEDKVANRVE EFETKVKQQF IDEPGQMRLL IVVDKLLTGF DAPSATYLYI DKHMSDHNLF       660
     QAICRVNRLD GDDKEYGYII DYKDLFRSLN KAISDYTKEV FDGYDKKDID GLLKNRLEQA       720
     RLNLDAALEM VRALCEPVKA PRNTVDYIHY FCCESGADPE LLSEKEALRL ALYQCVAKLL       780
     RAFANIANEM TIAGYSPAQM EKIRAEVAHY EKVRDEIKLA SKDKVEMKRY EPAMRSLIDM       840
     YIRADDSEVL MDFEEIGLLE LIIQKGAAAG EDLPEGIRKD PEAMAETIEN NVRKTIVDEN       900
     PVNPRYYEHM SVLLDELIAL RRQNALNYQE YLEKIRDLAK KVVRPNQNTA AYPPDIDTPP       960
     KRAFYDNFDQ NTDLAICIDK TIRDTKKADW VNDRFKEREI ANALRDETAE YKVDIDKIME      1020
     LAKTQRDYR                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page