(data stored in ACNUC1104 zone)

EMBL: FN667742.HSRA

FN667742.HSRA        Location/Qualifiers
FT   CDS             complement(46536..47918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsrA"
FT                   /locus_tag="XNC1_0044"
FT                   /product="putative permease of the major facilitator
FT                   superfamily; putative transmenmbrane domain"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88137"
FT                   /db_xref="GOA:D3VG47"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88137.1"
FT                   /translation="MVKSARNMSGLPWIAAMAFFMQSLDATILNTALPAIAKSLHHSPL
FT                   AMQPAIVSYTLTVAMLIPVSGWLADRFGTQRIFIYAVSLFSLGSLACALSHNLSFLVIS
FT                   RVIQGIGGAMMMPVARLALLRTYPRSELLPILNFVTMPGLLGPILGPMLGGLLVTYATW
FT                   HWIFIINIPIGLLGIIYARKNMPNLTMPKCPFDFLGFMLFGMGLVMISVSFDLFGDNSL
FT                   SSYIPLVLLPGGITMLLIYIFHAKRHKNPLIDLQLFQTHTFSIGIASNIATRLSTGSLS
FT                   FIIPLMLQVGFGYSAVIAGIMMAPNAIGSILAKSFVTKILTRFGYKNTLFWVTVIIGVM
FT                   ISQFSLQTPEMSVVLLIIPLFILGMAMSTQFTAMNTITLADLNDNNASAGNSLLAVTQQ
FT                   LSISFGVTVSAAVLRFYESMEYGSTVSHFHYTLITMGAITLISSTVFLFLNKEDGNNLI
FT                   NK"
     MVKSARNMSG LPWIAAMAFF MQSLDATILN TALPAIAKSL HHSPLAMQPA IVSYTLTVAM        60
     LIPVSGWLAD RFGTQRIFIY AVSLFSLGSL ACALSHNLSF LVISRVIQGI GGAMMMPVAR       120
     LALLRTYPRS ELLPILNFVT MPGLLGPILG PMLGGLLVTY ATWHWIFIIN IPIGLLGIIY       180
     ARKNMPNLTM PKCPFDFLGF MLFGMGLVMI SVSFDLFGDN SLSSYIPLVL LPGGITMLLI       240
     YIFHAKRHKN PLIDLQLFQT HTFSIGIASN IATRLSTGSL SFIIPLMLQV GFGYSAVIAG       300
     IMMAPNAIGS ILAKSFVTKI LTRFGYKNTL FWVTVIIGVM ISQFSLQTPE MSVVLLIIPL       360
     FILGMAMSTQ FTAMNTITLA DLNDNNASAG NSLLAVTQQL SISFGVTVSA AVLRFYESME       420
     YGSTVSHFHY TLITMGAITL ISSTVFLFLN KEDGNNLINK                             460
//

If you have problems or comments...

PBIL Back to PBIL home page