(data stored in ACNUC1104 zone)

EMBL: FN667742.ILVC

FN667742.ILVC        Location/Qualifiers
FT   CDS             308149..309627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="XNC1_0376"
FT                   /product="ketol-acid reductoisomerase, NAD(P)-binding"
FT                   /EC_number="1.1.1.86"
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 16164547; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88453"
FT                   /db_xref="GOA:D3VHW4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88453.1"
FT                   /translation="MANYFDTLNLRQQLAQLGKCRFMAREEFADEAGYLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDIAYALRKEAIEEKRASWRKATENGFRVGTYEELIPQADLVIN
FT                   LTPDKQHSSVVRAVQPLMKEGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDVKGEGMAIAKAWVAATGGHRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCYDKLVADGAEPSYAGKLIQFGWETITEALKQGGITLMMDRLSNSA
FT                   KLRAYALAEQLKTLLAPLFQKHMDDIISGAFSSTMMADWANDDKNLLTWREETGKTPFE
FT                   NYPDYSGNISEQEYFDHGVLMIAMVKAGVELAFDTMIDAGIIEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFSHIAVPLLKEKFMATLQAGDLGKEVADSGIDNAQ
FT                   LRDVNEAIRHHPIETIGHTLRGYMTDMKRIAVGG"
     MANYFDTLNL RQQLAQLGKC RFMAREEFAD EAGYLKGKKV VIVGCGAQGL NQGLNMRDSG        60
     LDIAYALRKE AIEEKRASWR KATENGFRVG TYEELIPQAD LVINLTPDKQ HSSVVRAVQP       120
     LMKEGAALGY SHGFNIVEVG EQIRKDITVV MVAPKCPGTE VREEYKRGFG VPTLIAVHPE       180
     NDVKGEGMAI AKAWVAATGG HRAGVLESSF VAEVKSDLMG EQTILCGMLQ AGSLLCYDKL       240
     VADGAEPSYA GKLIQFGWET ITEALKQGGI TLMMDRLSNS AKLRAYALAE QLKTLLAPLF       300
     QKHMDDIISG AFSSTMMADW ANDDKNLLTW REETGKTPFE NYPDYSGNIS EQEYFDHGVL       360
     MIAMVKAGVE LAFDTMIDAG IIEESAYYES LHELPLIANT IARKRLYEMN VVISDTAEYG       420
     NYLFSHIAVP LLKEKFMATL QAGDLGKEVA DSGIDNAQLR DVNEAIRHHP IETIGHTLRG       480
     YMTDMKRIAV GG                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page