(data stored in ACNUC1104 zone)

EMBL: FN667742.ILVM

FN667742.ILVM        Location/Qualifiers
FT   CDS             301066..301323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0068"
FT                   /gene="ilvM"
FT                   /locus_tag="XNC1_0369"
FT                   /product="acetolactate synthase II, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88446"
FT                   /db_xref="GOA:D3VHV7"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88446.1"
FT                   /translation="MMQHQLAIQARFCPEILERILRVTRHRGFQICALNMDQTTDSGNV
FT                   SIELTVSSQRSINLLFSQLMKLVDVAGIEIKHKESQLISA"
     MMQHQLAIQA RFCPEILERI LRVTRHRGFQ ICALNMDQTT DSGNVSIELT VSSQRSINLL        60
     FSQLMKLVDV AGIEIKHKES QLISA                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page