(data stored in ACNUC1104 zone)

EMBL: FN667742.MRCA

FN667742.MRCA        Location/Qualifiers
FT   CDS             69562..72072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="XNC1_0068"
FT                   /product="bifunctional penicillin-binding protein 1a:
FT                   transglycosylase (N-terminal); transpeptidase (C-terminal)"
FT                   /EC_number="2.4.2.-"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88156"
FT                   /db_xref="GOA:D3VG66"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88156.1"
FT                   /translation="MILIVVCILLGTASIFGLYKYIEPQLPDVATLKDVRLQTPMQVFS
FT                   ADDELIAQYGEKRRLPLTLSEMPPLMVKAFIATEDSRFYEHHGVDPIGIIRAVSVVMTS
FT                   GHATQGASTITQQLARNFFLSPEKTLIRKAKEAFLAIKIEQLLTKDEILELYLNKIYLG
FT                   QRAYGIGAAAQVYFGKTVNELTLSEMAMIAGLPKAPSTFNPLYSYDRAMSRRNVVLGRM
FT                   LEEGYITQRQYNEAREEKLVARYHGPQIVFSAPYLTEMARQEIINRYGENAYTDGYKVY
FT                   TTITRKAQLAAVNAVRTNVIDYDIRHGYRGAQEVLWKASQPAWDQALIINKLKTLPKYG
FT                   PLVPAVVTGSSANQAEAMLVDGSKVELTMAGVRWARSFKTDSLQGPVPRRVNDVIHAGE
FT                   QIWVRKVNDIWWLAQLPQVNAALVSINPLNGAVEALVGGFNFELSKFNRVTQSLRQVGS
FT                   NIKPFLYTAAMDKGLTLASLLNDAPISRWDAGAGTDWRPKNSPPTYDGPVRLRQGLGQS
FT                   KNVVMVRAMRAMGVDYAADYLKRFGLPGENVVRTESLALGSPSFTPMQLVRGYAVMANG
FT                   GYLVDPYFIARIENEEGNVLFEAKPKLACPQCENIPVIYGETARSIELSEDSIENVAHS
FT                   DEPQDSALPPQPDLERVSANTDVDDQQYAPHVISTPLAFLIHDALNTNVFGEPGWMGTG
FT                   WRAARDLKRRDIGGKTGTTNSSKDAWFSGYGPDIVATAWIGFDEHSRSLGRTPALKGEG
FT                   GAKTAQPIWDDFMKVALEGVPEKIMEPPAGIVSVTIDRATGKLSSGGGNTRKEYFIEGT
FT                   QPTEYAVPDVGTTVTENGESHELF"
     MILIVVCILL GTASIFGLYK YIEPQLPDVA TLKDVRLQTP MQVFSADDEL IAQYGEKRRL        60
     PLTLSEMPPL MVKAFIATED SRFYEHHGVD PIGIIRAVSV VMTSGHATQG ASTITQQLAR       120
     NFFLSPEKTL IRKAKEAFLA IKIEQLLTKD EILELYLNKI YLGQRAYGIG AAAQVYFGKT       180
     VNELTLSEMA MIAGLPKAPS TFNPLYSYDR AMSRRNVVLG RMLEEGYITQ RQYNEAREEK       240
     LVARYHGPQI VFSAPYLTEM ARQEIINRYG ENAYTDGYKV YTTITRKAQL AAVNAVRTNV       300
     IDYDIRHGYR GAQEVLWKAS QPAWDQALII NKLKTLPKYG PLVPAVVTGS SANQAEAMLV       360
     DGSKVELTMA GVRWARSFKT DSLQGPVPRR VNDVIHAGEQ IWVRKVNDIW WLAQLPQVNA       420
     ALVSINPLNG AVEALVGGFN FELSKFNRVT QSLRQVGSNI KPFLYTAAMD KGLTLASLLN       480
     DAPISRWDAG AGTDWRPKNS PPTYDGPVRL RQGLGQSKNV VMVRAMRAMG VDYAADYLKR       540
     FGLPGENVVR TESLALGSPS FTPMQLVRGY AVMANGGYLV DPYFIARIEN EEGNVLFEAK       600
     PKLACPQCEN IPVIYGETAR SIELSEDSIE NVAHSDEPQD SALPPQPDLE RVSANTDVDD       660
     QQYAPHVIST PLAFLIHDAL NTNVFGEPGW MGTGWRAARD LKRRDIGGKT GTTNSSKDAW       720
     FSGYGPDIVA TAWIGFDEHS RSLGRTPALK GEGGAKTAQP IWDDFMKVAL EGVPEKIMEP       780
     PAGIVSVTID RATGKLSSGG GNTRKEYFIE GTQPTEYAVP DVGTTVTENG ESHELF           836
//

If you have problems or comments...

PBIL Back to PBIL home page