(data stored in ACNUC1104 zone)

EMBL: FN667742.MSRA

FN667742.MSRA        Location/Qualifiers
FT   CDS             complement(407442..408089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0088"
FT                   /gene="msrA"
FT                   /locus_tag="XNC1_0477"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88551"
FT                   /db_xref="GOA:D3VIK1"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88551.1"
FT                   /translation="MPNSADESQHVSLQETLADRATPITVSPYHVITQHAINTIPENME
FT                   IAYVGMGCFWGVERLFWQQEGIYTTSVGYSGGITPNPTYEAVCTGSTGHAEVVRIIFDP
FT                   TKITYMQLLTLFWENHDPAQGMRQHGDIGTQYRSALYTVSPQQLEQALASREQFQQAMI
FT                   QNGDQRAITTEIREAGPFYFAEDYHQQYLYKNPEGYCGLGGMGICFPPTHRN"
     MPNSADESQH VSLQETLADR ATPITVSPYH VITQHAINTI PENMEIAYVG MGCFWGVERL        60
     FWQQEGIYTT SVGYSGGITP NPTYEAVCTG STGHAEVVRI IFDPTKITYM QLLTLFWENH       120
     DPAQGMRQHG DIGTQYRSAL YTVSPQQLEQ ALASREQFQQ AMIQNGDQRA ITTEIREAGP       180
     FYFAEDYHQQ YLYKNPEGYC GLGGMGICFP PTHRN                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page