(data stored in ACNUC1104 zone)

EMBL: FN667742.NLPI

FN667742.NLPI        Location/Qualifiers
FT   CDS             442339..443223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpI"
FT                   /locus_tag="XNC1_0510"
FT                   /product="NlpI lipoprotein believed to be involved in cell
FT                   division with transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88584"
FT                   /db_xref="GOA:D3VIN4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88584.1"
FT                   /translation="MNSFLRWCYVVAIFLLVGCSNTGWRKNEIIAIPLQPTLQQEVILA
FT                   RMEQILASRSLTEDEYAQLLYERGVLYDSLGLRALAQNDFSVALSIRPDIPEIFNYLGI
FT                   YFTQAGNFDSAYEAFDSVLELDPTYNYARMNRGIALYYGGRYRLAQDDLQAFYQDDPND
FT                   PFRSLWLYLVEAKIDPKVAMTNLSHHFDKANRGLWGWNIAEFYLGKISEKILMERLQQN
FT                   SADNTSLAEHLSETDFYLGKHYLSLGDEDSAVALFKLTVANNVHYFVEHRYALLELALL
FT                   SQRQDDLSESNQQ"
     MNSFLRWCYV VAIFLLVGCS NTGWRKNEII AIPLQPTLQQ EVILARMEQI LASRSLTEDE        60
     YAQLLYERGV LYDSLGLRAL AQNDFSVALS IRPDIPEIFN YLGIYFTQAG NFDSAYEAFD       120
     SVLELDPTYN YARMNRGIAL YYGGRYRLAQ DDLQAFYQDD PNDPFRSLWL YLVEAKIDPK       180
     VAMTNLSHHF DKANRGLWGW NIAEFYLGKI SEKILMERLQ QNSADNTSLA EHLSETDFYL       240
     GKHYLSLGDE DSAVALFKLT VANNVHYFVE HRYALLELAL LSQRQDDLSE SNQQ             294
//

If you have problems or comments...

PBIL Back to PBIL home page