(data stored in ACNUC1104 zone)

EMBL: FN667742.NRDG

FN667742.NRDG        Location/Qualifiers
FT   CDS             complement(454767..455231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0098"
FT                   /gene="nrdG"
FT                   /locus_tag="XNC1_0520"
FT                   /product="anaerobic ribonucleotide reductase activating
FT                   protein"
FT                   /EC_number="1.97.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88594"
FT                   /db_xref="GOA:D3VIP4"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88594.1"
FT                   /translation="MNYHQYYSVDAVNGPGTRCTLFVSGCLHQCRGCYNQSTWRSDSGL
FT                   PFTQATEDQIIADLKDHKIKRQGLSLSGGDPLHPQNVPAILQLVKRVRKECPDQDIWLW
FT                   TGYVLNELSEIQCEVINDINVLVDGKFEQALYDPTLIWRGSHNQIIHYLR"
     MNYHQYYSVD AVNGPGTRCT LFVSGCLHQC RGCYNQSTWR SDSGLPFTQA TEDQIIADLK        60
     DHKIKRQGLS LSGGDPLHPQ NVPAILQLVK RVRKECPDQD IWLWTGYVLN ELSEIQCEVI       120
     NDINVLVDGK FEQALYDPTL IWRGSHNQII HYLR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page