(data stored in ACNUC1104 zone)

EMBL: FN667742.PE109

FN667742.PE109       Location/Qualifiers
FT   CDS             109513..110598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0021"
FT                   /locus_tag="XNC1_0114"
FT                   /product="aminotransferase"
FT                   /EC_number="3.1.13.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88202"
FT                   /db_xref="GOA:D3VGB2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88202.1"
FT                   /translation="MQFTDLAAQQLRIKDKIDQNIQKVLTHGKYILGPEVSELEEKLVE
FT                   YTGAKYCITCANGTDALQIALMAIGIKPGDEVITPGFTYIATAETVALLGGIPVYVDVK
FT                   QTTYNLDPELLEAAITPKTKAIIPVSLYGQCADFDEINAIAEKYNITVIEDAAQSFGAS
FT                   YKGKRSCNLTTISCTSFFPSKPLGCYGDGGAIFTSDEELAKVIRQIARHGQDRRYHHIR
FT                   VGINSRLDTLQAAILLPKLEIFDEEMALRQIVAKNYDKVLNEIGIITTPYIELHNISAY
FT                   AQYTIRVQNRDELQNKLKEKGIPTAVHYPLPLNKQPAVASGVVLPVGDQIAQEVISIPM
FT                   HPYLTEIQVLNITNILINHLK"
     MQFTDLAAQQ LRIKDKIDQN IQKVLTHGKY ILGPEVSELE EKLVEYTGAK YCITCANGTD        60
     ALQIALMAIG IKPGDEVITP GFTYIATAET VALLGGIPVY VDVKQTTYNL DPELLEAAIT       120
     PKTKAIIPVS LYGQCADFDE INAIAEKYNI TVIEDAAQSF GASYKGKRSC NLTTISCTSF       180
     FPSKPLGCYG DGGAIFTSDE ELAKVIRQIA RHGQDRRYHH IRVGINSRLD TLQAAILLPK       240
     LEIFDEEMAL RQIVAKNYDK VLNEIGIITT PYIELHNISA YAQYTIRVQN RDELQNKLKE       300
     KGIPTAVHYP LPLNKQPAVA SGVVLPVGDQ IAQEVISIPM HPYLTEIQVL NITNILINHL       360
     K                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page