(data stored in ACNUC1104 zone)

EMBL: FN667742.PE112

FN667742.PE112       Location/Qualifiers
FT   CDS             112913..113935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0022"
FT                   /locus_tag="XNC1_0117"
FT                   /product="putative Glycosyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88205"
FT                   /db_xref="GOA:D3VGB5"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88205.1"
FT                   /translation="MYTFMISFITRNNPLTHPVLIALATALKRINNENDIQIKNLTSFF
FT                   INFYISHDNYKNANWIVVDDPIAFLYCVYKLKINHKKIIFYSLEMYEHQLLNDNLKNKM
FT                   RNSLFSLAHKHAQKKSFKIIFPSQNRLDFYLNCRNENHIKNKSVVIYNYPESNSLSIEK
FT                   PNDTYINLIETLKSNNKKIIIYAGSIQKGRDLEKFMSQLATSENHHLILIGHNKNYSNE
FT                   YFKTINNVSFLGPLPRKQVNYFYEQADIGLLQYENEPLNTKLCAPVKLWEYLYFKLNII
FT                   SNSNYAMQTEWKSHVDYFYKTNEDLMKILSVSEHKNKYLTDIPFLEEEIVSFIRDKLIP
FT                   "
     MYTFMISFIT RNNPLTHPVL IALATALKRI NNENDIQIKN LTSFFINFYI SHDNYKNANW        60
     IVVDDPIAFL YCVYKLKINH KKIIFYSLEM YEHQLLNDNL KNKMRNSLFS LAHKHAQKKS       120
     FKIIFPSQNR LDFYLNCRNE NHIKNKSVVI YNYPESNSLS IEKPNDTYIN LIETLKSNNK       180
     KIIIYAGSIQ KGRDLEKFMS QLATSENHHL ILIGHNKNYS NEYFKTINNV SFLGPLPRKQ       240
     VNYFYEQADI GLLQYENEPL NTKLCAPVKL WEYLYFKLNI ISNSNYAMQT EWKSHVDYFY       300
     KTNEDLMKIL SVSEHKNKYL TDIPFLEEEI VSFIRDKLIP                             340
//

If you have problems or comments...

PBIL Back to PBIL home page