(data stored in ACNUC1104 zone)

EMBL: FN667742.PE114

FN667742.PE114       Location/Qualifiers
FT   CDS             115441..115656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88207"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88207.1"
FT                   /translation="MTMLPLYGNSIQFICEMDGALGKAALFFLRLAGESPVVEGKPDHY
FT                   VASLASPAVTKEMKRRQRNVRAETDG"
     MTMLPLYGNS IQFICEMDGA LGKAALFFLR LAGESPVVEG KPDHYVASLA SPAVTKEMKR        60
     RQRNVRAETD G                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page