(data stored in ACNUC1104 zone)

EMBL: FN667742.PE124

FN667742.PE124       Location/Qualifiers
FT   CDS             complement(119537..119725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88217"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88217.1"
FT                   /translation="MLVSRPTQSPRQAPCILKFDYHKNDLAQCMQLASPEGFKPVEELL
FT                   THTLSHSSETRTVVRHP"
     MLVSRPTQSP RQAPCILKFD YHKNDLAQCM QLASPEGFKP VEELLTHTLS HSSETRTVVR        60
     HP                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page