(data stored in ACNUC1104 zone)

EMBL: FN667742.PE127

FN667742.PE127       Location/Qualifiers
FT   CDS             121308..121946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0023"
FT                   /locus_tag="XNC1_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88220"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88220.1"
FT                   /translation="MINNFNSVLVLAPHTDDGELGAGGTIAKLIENGKKITYVAFSTAE
FT                   ESVPKGMEKDILKTEVKAATKALGIKNDNLIIFNYQVRKLNYARQEILENLIEIRKKNK
FT                   FDLILMPSLKDIHQDHTTIAQEGLRAFKNATILGYELIWNNLSFDTTCFIKLDKHHIQK
FT                   KVSALHKYESQKNRDYMSEDFIFSLARTRGVQIGTKYAESFEVIRCVIN"
     MINNFNSVLV LAPHTDDGEL GAGGTIAKLI ENGKKITYVA FSTAEESVPK GMEKDILKTE        60
     VKAATKALGI KNDNLIIFNY QVRKLNYARQ EILENLIEIR KKNKFDLILM PSLKDIHQDH       120
     TTIAQEGLRA FKNATILGYE LIWNNLSFDT TCFIKLDKHH IQKKVSALHK YESQKNRDYM       180
     SEDFIFSLAR TRGVQIGTKY AESFEVIRCV IN                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page