(data stored in ACNUC1104 zone)

EMBL: FN667742.PE129

FN667742.PE129       Location/Qualifiers
FT   CDS             122814..124049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0023"
FT                   /locus_tag="XNC1_0134"
FT                   /product="putative glycosyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88222"
FT                   /db_xref="GOA:D3VGD2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88222.1"
FT                   /translation="MNILYINHYAGSPYHGMEFRPYYLAKEWLNNGHKITILASSFSHV
FT                   RSKQPNIKHKITEENIDGIHYIWYPTNKYKGNGILRVINIFSFLLQIILFNKKIIKKTK
FT                   PNIILASSTYPLDIWVAKYLAKKHKAKLIFEIHDLWPLSPIELGGMSPKHPFMTLCQYA
FT                   ENSAYKYSDAVISILPKVHQHVIKHGLDINKLHIIPNGIVYSDWEDGNYDKIPDNIRSK
FT                   INTLKNKGYTIVGYSGSHGIPNALRYLIEAADLLRDKPFHFILVGSGLEKNNLLEYKNS
FT                   LDLENITFFEPITKKQMPDLLTLFDISYIGAHKTPIYRFGISPNKLMDYMMAENVILSS
FT                   IEAGNDPVTDAACGITVEAESSKAIADALIKLSEYSLEEKQQMGKNGKNYVLKNHTYSV
FT                   LADKFLQVMKKL"
     MNILYINHYA GSPYHGMEFR PYYLAKEWLN NGHKITILAS SFSHVRSKQP NIKHKITEEN        60
     IDGIHYIWYP TNKYKGNGIL RVINIFSFLL QIILFNKKII KKTKPNIILA SSTYPLDIWV       120
     AKYLAKKHKA KLIFEIHDLW PLSPIELGGM SPKHPFMTLC QYAENSAYKY SDAVISILPK       180
     VHQHVIKHGL DINKLHIIPN GIVYSDWEDG NYDKIPDNIR SKINTLKNKG YTIVGYSGSH       240
     GIPNALRYLI EAADLLRDKP FHFILVGSGL EKNNLLEYKN SLDLENITFF EPITKKQMPD       300
     LLTLFDISYI GAHKTPIYRF GISPNKLMDY MMAENVILSS IEAGNDPVTD AACGITVEAE       360
     SSKAIADALI KLSEYSLEEK QQMGKNGKNY VLKNHTYSVL ADKFLQVMKK L                411
//

If you have problems or comments...

PBIL Back to PBIL home page