(data stored in ACNUC1104 zone)

EMBL: FN667742.PE13

FN667742.PE13        Location/Qualifiers
FT   CDS             complement(12161..12286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88106"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88106.1"
FT                   /translation="MDLGIFAQQSNNAISFVQPLGCTSNHFHGLLFLKRLVLMVC"
     MDLGIFAQQS NNAISFVQPL GCTSNHFHGL LFLKRLVLMV C                            41
//

If you have problems or comments...

PBIL Back to PBIL home page