(data stored in ACNUC1104 zone)

EMBL: FN667742.PE131

FN667742.PE131       Location/Qualifiers
FT   CDS             125204..125815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0023"
FT                   /locus_tag="XNC1_0136"
FT                   /product="Putative glycosyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88224"
FT                   /db_xref="GOA:D3VGD4"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88224.1"
FT                   /translation="MKLTYDFFKRLFDFISSFMGMVILSPILIFIALWIKMDSKGPIFF
FT                   RQKRVGKYGKPFYIHKFRSMTLDAEEKGQLTIGNDSRITSSGKFIRKYKLDELAQLIDV
FT                   LLGTMSLVGPRPEVPKFIDKYPLDIRKKILSVKPGITDLASIEMINENEILSQYPDPHQ
FT                   AYIDIIMPIKAKYYLDYVKQKSFFLDVKIIFKTIYKIIFR"
     MKLTYDFFKR LFDFISSFMG MVILSPILIF IALWIKMDSK GPIFFRQKRV GKYGKPFYIH        60
     KFRSMTLDAE EKGQLTIGND SRITSSGKFI RKYKLDELAQ LIDVLLGTMS LVGPRPEVPK       120
     FIDKYPLDIR KKILSVKPGI TDLASIEMIN ENEILSQYPD PHQAYIDIIM PIKAKYYLDY       180
     VKQKSFFLDV KIIFKTIYKI IFR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page