(data stored in ACNUC1104 zone)

EMBL: FN667742.PE140

FN667742.PE140       Location/Qualifiers
FT   CDS             131754..132095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0026"
FT                   /locus_tag="XNC1_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88233"
FT                   /db_xref="GOA:D3VGU8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88233.1"
FT                   /translation="MSEGLFEGVIMAKARLHDDAMVQLLREDPEFAQYYLHQAFVDMDE
FT                   EGGQEAFLMALRHVVEARGGMAQIADKAGVSRETLYRTLSPKGNPTLKTLRNIIAATGF
FT                   PLSHLAAMI"
     MSEGLFEGVI MAKARLHDDA MVQLLREDPE FAQYYLHQAF VDMDEEGGQE AFLMALRHVV        60
     EARGGMAQIA DKAGVSRETL YRTLSPKGNP TLKTLRNIIA ATGFPLSHLA AMI              113
//

If you have problems or comments...

PBIL Back to PBIL home page