(data stored in ACNUC1104 zone)

EMBL: FN667742.PE142

FN667742.PE142       Location/Qualifiers
FT   CDS             133687..134736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0027"
FT                   /locus_tag="XNC1_0147"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88235"
FT                   /db_xref="GOA:D3VGV0"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88235.1"
FT                   /translation="MMKMKYLLIKHVGLFTLLFWILSFFTSVSFTLNARAARLAIVIDD
FT                   VGYRIHEENKILQMPIAVSVAILPDSPHGREMAVKAYQQGREVLIHLPMAPLSQQPLEK
FT                   NTLHPAMSREEIGRIIQEAIQKVPHAVGMNNHMGSAMTSDLTGMEKVMQVLSRHHLYFL
FT                   DSVTIGNTQVTKAATGTSVPVIRRNIFLDNVQTEAETRHQFNRAITLARKKGSAIAIGH
FT                   PHPTTVRALQQALATLPDDIELVTPGILLGHEPSNKREQQITRQCTKPRQSEPVPETQL
FT                   DYLKEIGKALANNIIVNTLSQHFQKLLQSVPKQEAPNTLNKTIGGQVTVNQDAGKKKSH
FT                   QKEDQTRCP"
     MMKMKYLLIK HVGLFTLLFW ILSFFTSVSF TLNARAARLA IVIDDVGYRI HEENKILQMP        60
     IAVSVAILPD SPHGREMAVK AYQQGREVLI HLPMAPLSQQ PLEKNTLHPA MSREEIGRII       120
     QEAIQKVPHA VGMNNHMGSA MTSDLTGMEK VMQVLSRHHL YFLDSVTIGN TQVTKAATGT       180
     SVPVIRRNIF LDNVQTEAET RHQFNRAITL ARKKGSAIAI GHPHPTTVRA LQQALATLPD       240
     DIELVTPGIL LGHEPSNKRE QQITRQCTKP RQSEPVPETQ LDYLKEIGKA LANNIIVNTL       300
     SQHFQKLLQS VPKQEAPNTL NKTIGGQVTV NQDAGKKKSH QKEDQTRCP                   349
//

If you have problems or comments...

PBIL Back to PBIL home page