(data stored in ACNUC1104 zone)

EMBL: FN667742.PE149

FN667742.PE149       Location/Qualifiers
FT   CDS             complement(141654..142040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88242"
FT                   /db_xref="InterPro:IPR009977"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88242.1"
FT                   /translation="MDIYIDLYQKRWNYNHSEEQKKHLLEIYTELRDHIFGYVLLINSK
FT                   PCAYDFVLWAESPKWISFDAINGGYDPEYAHLSVGSILMWVNIQQAKVLCQQGDKTMRY
FT                   SLGNPTLEYKNRWCETFPLGKVLF"
     MDIYIDLYQK RWNYNHSEEQ KKHLLEIYTE LRDHIFGYVL LINSKPCAYD FVLWAESPKW        60
     ISFDAINGGY DPEYAHLSVG SILMWVNIQQ AKVLCQQGDK TMRYSLGNPT LEYKNRWCET       120
     FPLGKVLF                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page