(data stored in ACNUC1104 zone)

EMBL: FN667742.PE151

FN667742.PE151       Location/Qualifiers
FT   CDS             complement(144167..145132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88244"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88244.1"
FT                   /translation="MITKTPDTHSACSKILSIIVAAHNLEKLILKCINSIKNTLSDLEP
FT                   SLYEVLLIDDSSSDSTSSILKQFSEENSSFIYIRKEFKSLGKVKKYAVEQSNGEYITFV
FT                   DGDDFLSNFSMKNIIDFLIEKRPDMLISPLQDVRKPEDIIHKSNFLSPILFDRNTAIKE
FT                   YLIHKKFQAHSCGKFFRRDLFDGSNFPEVSCYEDALSFSSILAKCDRIYYTRTKYYNYI
FT                   KREGSLSESINKAKINAMAEVVFIDDKVFGEKFRNLTACHAIEIAYKYHNFLSRNYFSS
FT                   LMNLINSISIFSFMLDNRVRFSFKVKYYKVMMNKKIINNK"
     MITKTPDTHS ACSKILSIIV AAHNLEKLIL KCINSIKNTL SDLEPSLYEV LLIDDSSSDS        60
     TSSILKQFSE ENSSFIYIRK EFKSLGKVKK YAVEQSNGEY ITFVDGDDFL SNFSMKNIID       120
     FLIEKRPDML ISPLQDVRKP EDIIHKSNFL SPILFDRNTA IKEYLIHKKF QAHSCGKFFR       180
     RDLFDGSNFP EVSCYEDALS FSSILAKCDR IYYTRTKYYN YIKREGSLSE SINKAKINAM       240
     AEVVFIDDKV FGEKFRNLTA CHAIEIAYKY HNFLSRNYFS SLMNLINSIS IFSFMLDNRV       300
     RFSFKVKYYK VMMNKKIINN K                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page