(data stored in ACNUC1104 zone)

EMBL: FN667742.PE154

FN667742.PE154       Location/Qualifiers
FT   CDS             complement(147449..148579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0030"
FT                   /locus_tag="XNC1_0159"
FT                   /product="Lipopolysaccharide core biosynthesis protein RfaG
FT                   (Glucosyltransferase I)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88247"
FT                   /db_xref="GOA:D3VGW2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88247.1"
FT                   /translation="MKSIRLAIVRQKYRPDGGAERFISRALEALDNDSLDLNVITRSWQ
FT                   GDINPNWHVHLAAPFKWGRISREKRFADAAKAIWQKEHFDIVQSHERIAGCDIYRAGDG
FT                   VHQRWLQQRSRILPAWKSKLLFTSRYHRYVMNAEEEMYLAPELKKVICNSQMIKREVME
FT                   NFGLPDEKISVIYNAIDQSEFFPAGEDERLVLRQKYALPAQAKCFVYVGSGFERKGLKA
FT                   AIEAIGMTKDYLVVIGQDKEENKYKQLAHSLGCHDRIRFLGVQKETLPFYQMADGLLLP
FT                   TLYDPFPNVVLEAMACGLPVITSHTCGGSEFITSGENGFVCDALDISGLAESISSVPAD
FT                   HLTSRFSMLSKEKIVNYTPAYLSQQLTELYNKVLSL"
     MKSIRLAIVR QKYRPDGGAE RFISRALEAL DNDSLDLNVI TRSWQGDINP NWHVHLAAPF        60
     KWGRISREKR FADAAKAIWQ KEHFDIVQSH ERIAGCDIYR AGDGVHQRWL QQRSRILPAW       120
     KSKLLFTSRY HRYVMNAEEE MYLAPELKKV ICNSQMIKRE VMENFGLPDE KISVIYNAID       180
     QSEFFPAGED ERLVLRQKYA LPAQAKCFVY VGSGFERKGL KAAIEAIGMT KDYLVVIGQD       240
     KEENKYKQLA HSLGCHDRIR FLGVQKETLP FYQMADGLLL PTLYDPFPNV VLEAMACGLP       300
     VITSHTCGGS EFITSGENGF VCDALDISGL AESISSVPAD HLTSRFSMLS KEKIVNYTPA       360
     YLSQQLTELY NKVLSL                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page