(data stored in ACNUC1104 zone)

EMBL: FN667742.PE166

FN667742.PE166       Location/Qualifiers
FT   CDS             complement(157963..158967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0033"
FT                   /locus_tag="XNC1_0171"
FT                   /product="WalO protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88259"
FT                   /db_xref="GOA:D3VGX4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88259.1"
FT                   /translation="MQPKNILIINIARFGDTLLATPVIRALKAKWPEANIDVFAHKKTK
FT                   EILYNIELIYELKAFSKGKAKWCGWLSRRHYDFALVYGDDKSLLQYAKRQSNLTIYFSD
FT                   TSEEKVNEYTVEKPRDPMPAQQERALLIRALGVEVNDWRLHYCVSQSEEEYARDFLQRQ
FT                   ELEHQLKIGFQLQSFPAKAYRDWPVEHFYELAQRIYRDYPHAHILLLGSKEGEKCAQML
FT                   AEKLGANRCTSLAGKTTMRQNAAIMSRLDLYIGVDTGTTHLAGALGIPMVALYHSFHPG
FT                   RFLAPQQHPKLAVIEHPVDSRQATRQDSMSAISVDKVWHSVQNLLENERKDNE"
     MQPKNILIIN IARFGDTLLA TPVIRALKAK WPEANIDVFA HKKTKEILYN IELIYELKAF        60
     SKGKAKWCGW LSRRHYDFAL VYGDDKSLLQ YAKRQSNLTI YFSDTSEEKV NEYTVEKPRD       120
     PMPAQQERAL LIRALGVEVN DWRLHYCVSQ SEEEYARDFL QRQELEHQLK IGFQLQSFPA       180
     KAYRDWPVEH FYELAQRIYR DYPHAHILLL GSKEGEKCAQ MLAEKLGANR CTSLAGKTTM       240
     RQNAAIMSRL DLYIGVDTGT THLAGALGIP MVALYHSFHP GRFLAPQQHP KLAVIEHPVD       300
     SRQATRQDSM SAISVDKVWH SVQNLLENER KDNE                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page