(data stored in ACNUC1104 zone)

EMBL: FN667742.PE17

FN667742.PE17        Location/Qualifiers
FT   CDS             complement(15323..16057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0003"
FT                   /locus_tag="XNC1_0017"
FT                   /product="Zinc metalloprotease"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12125824; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88110"
FT                   /db_xref="GOA:D3VG20"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88110.1"
FT                   /translation="MAQLKIGEIDMQLNRKAIKNLHISVLPPDGIVRISAPMHMSDTAI
FT                   RMAVISRIPWIKKQQQDFARQPRQSEREMVNGECHYLWGRRHRLNIVEHVGKQQVKTSG
FT                   GKIYLYVPYGAPFEKKAQVLSDYYRAALKERIEKLLMHWQPIIGVMPSSWGIKKMKTKW
FT                   GSCNTVSGSIWLNLELAKKPLECLEFILVHELVHLLERKHNERFMTYMDGYLPDWRERK
FT                   RLLSILPLSNDVLVQTRSDTSV"
     MAQLKIGEID MQLNRKAIKN LHISVLPPDG IVRISAPMHM SDTAIRMAVI SRIPWIKKQQ        60
     QDFARQPRQS EREMVNGECH YLWGRRHRLN IVEHVGKQQV KTSGGKIYLY VPYGAPFEKK       120
     AQVLSDYYRA ALKERIEKLL MHWQPIIGVM PSSWGIKKMK TKWGSCNTVS GSIWLNLELA       180
     KKPLECLEFI LVHELVHLLE RKHNERFMTY MDGYLPDWRE RKRLLSILPL SNDVLVQTRS       240
     DTSV                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page