(data stored in ACNUC1104 zone)

EMBL: FN667742.PE186

FN667742.PE186       Location/Qualifiers
FT   CDS             172847..175561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0038"
FT                   /locus_tag="XNC1_0191"
FT                   /product="Putative prophage primase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88279"
FT                   /db_xref="GOA:D3VGZ4"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88279.1"
FT                   /translation="MNNQNYPNASTIPTSIPSVTDIVKAANGRWYYILSNLGVSVPENN
FT                   KHGACPKCGGKDRFRFDDKNGKGTWFCNHCGSGDGLDLLKLVTGQDTKTACSEINKILL
FT                   LPEFKKITPTRVKKVGAQKGIELFEKLKTLCFSGESQYLSNKGLTHHNYLITQQQYTQS
FT                   NIIFPIGSLLLPLVDNQRSLKGGQLISPKGEKSLLAGSALSASFIVVVDEADKNIEQVV
FT                   ITEGFATGLSLSKVIDAFIVAAVAATNLVKVAQQLRERWPQAKIIIAGDNDLIDGKENT
FT                   GRSWAEKAAKAVDGWVTLPPTHYKSDWDDYRQENNADKVKEAFFEEMTYCGKDKTYLPQ
FT                   GFRLTQEYLWYDKLVNKSDGDTEVRNIKISSPIKVTAITCDADSSNYGRLLEWEDTYGN
FT                   CRKWAMPMEMLSGSGEELRRVLLVNGLSYINISGQARAHLMEYISLCRPERKVTCVNKT
FT                   GWHGNVYVLQDEVVGAGADSVILQTSSVQGKDFRVSGSSEEWREHIGKYCVGNARLAFS
FT                   VSLAFASSLLKLVGVGGGGYHLKGESTDGKTTTMKVAASVCGGTDYWYTWRATGNALEG
FT                   TACRRNDATLMLDEIREVDGREAGNIAYMLANGQGKARAKTDGSVRETNRWNLLFLSTG
FT                   ELSLVEHASNAGERTYAGVEVRMIQIPSDSGKHGVFEDLHQFASGKSLAEYLEQAVTKY
FT                   HGSPFRDWLKYLTHDLTSISGTAKALLKEYTANMMPENAGNQVGRAITRFALVAMAGEI
FT                   ATRAGITGWQQGEAYAAAEKCLAAWMKERGHTANQEDITALEQVTDFISRNQFSRFADW
FT                   YDENSRPLNMMGFRRVEKGTANQDPTVQFYVLSSAWKEICKGFDSRKVARLCVEKGWLE
FT                   AGKDGRIQTSIRLPEIGLKRVYLFNSDVLGSAE"
     MNNQNYPNAS TIPTSIPSVT DIVKAANGRW YYILSNLGVS VPENNKHGAC PKCGGKDRFR        60
     FDDKNGKGTW FCNHCGSGDG LDLLKLVTGQ DTKTACSEIN KILLLPEFKK ITPTRVKKVG       120
     AQKGIELFEK LKTLCFSGES QYLSNKGLTH HNYLITQQQY TQSNIIFPIG SLLLPLVDNQ       180
     RSLKGGQLIS PKGEKSLLAG SALSASFIVV VDEADKNIEQ VVITEGFATG LSLSKVIDAF       240
     IVAAVAATNL VKVAQQLRER WPQAKIIIAG DNDLIDGKEN TGRSWAEKAA KAVDGWVTLP       300
     PTHYKSDWDD YRQENNADKV KEAFFEEMTY CGKDKTYLPQ GFRLTQEYLW YDKLVNKSDG       360
     DTEVRNIKIS SPIKVTAITC DADSSNYGRL LEWEDTYGNC RKWAMPMEML SGSGEELRRV       420
     LLVNGLSYIN ISGQARAHLM EYISLCRPER KVTCVNKTGW HGNVYVLQDE VVGAGADSVI       480
     LQTSSVQGKD FRVSGSSEEW REHIGKYCVG NARLAFSVSL AFASSLLKLV GVGGGGYHLK       540
     GESTDGKTTT MKVAASVCGG TDYWYTWRAT GNALEGTACR RNDATLMLDE IREVDGREAG       600
     NIAYMLANGQ GKARAKTDGS VRETNRWNLL FLSTGELSLV EHASNAGERT YAGVEVRMIQ       660
     IPSDSGKHGV FEDLHQFASG KSLAEYLEQA VTKYHGSPFR DWLKYLTHDL TSISGTAKAL       720
     LKEYTANMMP ENAGNQVGRA ITRFALVAMA GEIATRAGIT GWQQGEAYAA AEKCLAAWMK       780
     ERGHTANQED ITALEQVTDF ISRNQFSRFA DWYDENSRPL NMMGFRRVEK GTANQDPTVQ       840
     FYVLSSAWKE ICKGFDSRKV ARLCVEKGWL EAGKDGRIQT SIRLPEIGLK RVYLFNSDVL       900
     GSAE                                                                    904
//

If you have problems or comments...

PBIL Back to PBIL home page