(data stored in ACNUC1104 zone)

EMBL: FN667742.PE198

FN667742.PE198       Location/Qualifiers
FT   CDS             180176..180574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0040"
FT                   /locus_tag="XNC1_0203"
FT                   /product="Death on curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88291"
FT                   /db_xref="GOA:D3VH06"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88291.1"
FT                   /translation="MIWVSAQEVIAFHDRILQRLPGVAGMPDSGRAEALIYRVQNRTHH
FT                   EGITDIFELAATYWAAIARGHIFNDGNKRTAFFVTMTFLYRNGIKIRDNDNTLENLTVD
FT                   AATGEKTVDQLAQHLRELVDYTNPSCNP"
     MIWVSAQEVI AFHDRILQRL PGVAGMPDSG RAEALIYRVQ NRTHHEGITD IFELAATYWA        60
     AIARGHIFND GNKRTAFFVT MTFLYRNGIK IRDNDNTLEN LTVDAATGEK TVDQLAQHLR       120
     ELVDYTNPSC NP                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page