(data stored in ACNUC1104 zone)

EMBL: FN667742.PE204

FN667742.PE204       Location/Qualifiers
FT   CDS             complement(183926..184546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0042"
FT                   /locus_tag="XNC1_0209"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88297"
FT                   /db_xref="InterPro:IPR009918"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88297.1"
FT                   /translation="MKTGMNKLLLTILIAFGLCLPLSATAGEPSVTPEINSSLMYLLPD
FT                   SPTFEDTIPVFREKYNKKHAEILLYEYKVVASKDISQPFIRAASKINDKIYSSAVLERG
FT                   SEKIKSLQITLLPSQNKQEDEQNFILAKQYMTALISQFEPTFSLEQAKNQLEKLLQAAG
FT                   KHPVFSQKMGAVRYVIVNSSENIMTFAIEPIKLSLSDASANEN"
     MKTGMNKLLL TILIAFGLCL PLSATAGEPS VTPEINSSLM YLLPDSPTFE DTIPVFREKY        60
     NKKHAEILLY EYKVVASKDI SQPFIRAASK INDKIYSSAV LERGSEKIKS LQITLLPSQN       120
     KQEDEQNFIL AKQYMTALIS QFEPTFSLEQ AKNQLEKLLQ AAGKHPVFSQ KMGAVRYVIV       180
     NSSENIMTFA IEPIKLSLSD ASANEN                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page