(data stored in ACNUC1104 zone)

EMBL: FN667742.PE205

FN667742.PE205       Location/Qualifiers
FT   CDS             184389..185051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0210"
FT                   /product="putative membrane protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88298"
FT                   /db_xref="GOA:D3VH13"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88298.1"
FT                   /translation="MVSSNVGESGSRYINDEFISGVTEGSPAVADNGKQRPKAINIVSR
FT                   SLFMPVFILLLVELNIGKTASTIGKEYMTLQQWGFSFKGRIGRREFWIGIGICFALIFT
FT                   LFTLHGMNVLSMNYAAVGVVLLLCPTAAIFSKRLHDRNKRGGWVLLLALAWVLLSLDWE
FT                   LMAPVWQWGVGRFVPTLIFVMIILDCGVFRGTEGANRFGQMAEMVDYISANEPTQKG"
     MVSSNVGESG SRYINDEFIS GVTEGSPAVA DNGKQRPKAI NIVSRSLFMP VFILLLVELN        60
     IGKTASTIGK EYMTLQQWGF SFKGRIGRRE FWIGIGICFA LIFTLFTLHG MNVLSMNYAA       120
     VGVVLLLCPT AAIFSKRLHD RNKRGGWVLL LALAWVLLSL DWELMAPVWQ WGVGRFVPTL       180
     IFVMIILDCG VFRGTEGANR FGQMAEMVDY ISANEPTQKG                             220
//

If you have problems or comments...

PBIL Back to PBIL home page