(data stored in ACNUC1104 zone)

EMBL: FN667742.PE228

FN667742.PE228       Location/Qualifiers
FT   CDS             complement(207395..208783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0051"
FT                   /locus_tag="XNC1_0233"
FT                   /product="Sea14 (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88321"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88321.1"
FT                   /translation="MKIVMTAMVIHDDGSTTQETLLTLQKTAEQDEPLGLSLNESKKLL
FT                   NHAQLSIIQSQTQAYMQTHRECPHCHQRRQIKDHQTRHYHTLFGVIPIKGLRLYRCNCE
FT                   RNNTKSVSLLSEWLPENIHPELKYIEAKWASLMSYNLTVDRLKDILPINKALNASTVRN
FT                   HLISVARRQEAELAEKPDFLNKTADDNDNLPRPGKPMVIGFDGGYIRDCHNRKNNFEII
FT                   TGKAYAENIQAKRFGYVHMFENNPRKRLLSVLGAQGMQTNQQISFLSDGADNLRMMQIG
FT                   IYPEAEHILDWFHISMRLTVLNQCAKGLITQSTDIGSILQNLLEKTKWYLWHGNVDEAL
FT                   DQLDSCLYTCDNEEDNPVYKHSKKMVRYLDEMMTYIGNNQAMIPNYGERHRYGEPISTA
FT                   FVESTVNEVIAKRMAKKQQMQWSQEGAHYLLQTRVAVLNDELESLFHCWYPKLASSGLN
FT                   AMAA"
     MKIVMTAMVI HDDGSTTQET LLTLQKTAEQ DEPLGLSLNE SKKLLNHAQL SIIQSQTQAY        60
     MQTHRECPHC HQRRQIKDHQ TRHYHTLFGV IPIKGLRLYR CNCERNNTKS VSLLSEWLPE       120
     NIHPELKYIE AKWASLMSYN LTVDRLKDIL PINKALNAST VRNHLISVAR RQEAELAEKP       180
     DFLNKTADDN DNLPRPGKPM VIGFDGGYIR DCHNRKNNFE IITGKAYAEN IQAKRFGYVH       240
     MFENNPRKRL LSVLGAQGMQ TNQQISFLSD GADNLRMMQI GIYPEAEHIL DWFHISMRLT       300
     VLNQCAKGLI TQSTDIGSIL QNLLEKTKWY LWHGNVDEAL DQLDSCLYTC DNEEDNPVYK       360
     HSKKMVRYLD EMMTYIGNNQ AMIPNYGERH RYGEPISTAF VESTVNEVIA KRMAKKQQMQ       420
     WSQEGAHYLL QTRVAVLNDE LESLFHCWYP KLASSGLNAM AA                          462
//

If you have problems or comments...

PBIL Back to PBIL home page