(data stored in ACNUC1104 zone)

EMBL: FN667742.PE230

FN667742.PE230       Location/Qualifiers
FT   CDS             complement(209048..209368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0051"
FT                   /locus_tag="XNC1_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88323"
FT                   /db_xref="GOA:D3VH38"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88323.1"
FT                   /translation="MIYAYIRISSAEQNSARQKIAIQNSGYEIKTVFTDIASGKDTHRP
FT                   NLQQLLSTLISGDTLIVHSIDRLCRNMMDMCYLTLDLKQRGISLIFLKENICFSAHENN
FT                   PL"
     MIYAYIRISS AEQNSARQKI AIQNSGYEIK TVFTDIASGK DTHRPNLQQL LSTLISGDTL        60
     IVHSIDRLCR NMMDMCYLTL DLKQRGISLI FLKENICFSA HENNPL                      106
//

If you have problems or comments...

PBIL Back to PBIL home page