(data stored in ACNUC1104 zone)

EMBL: FN667742.PE239

FN667742.PE239       Location/Qualifiers
FT   CDS             215140..216159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0052"
FT                   /locus_tag="XNC1_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88332"
FT                   /db_xref="GOA:D3VH47"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88332.1"
FT                   /translation="MNGNFAGGYSAPDFILARNDSELVSAMPQNMAAGYFRTDLMPEVF
FT                   YHKCAQYTAIKTLAPELVFNGRSVNTLTELPRKVVKPMVIRPAFSPQSKGSALIVGGND
FT                   RPSMDDVIQQLRHYSGPFQLHDYEEGQPLFINGILSIGTLIISDMWRCITLPIGYRDIL
FT                   TAVINLSEKALPEGLPQQLAELAIGMGMLAGPLHIELVLTADGPKIVKLTPRLASSPLP
FT                   DLCHFGGWQSQQQLWQTKSCNIQHKSLIGYVADYSFIFLQAGRVKQFFFEKEIKALSSF
FT                   SYYFMSPKIGQDVQMTIDGDTYGCTLFLRNNSLEILESEIAYLTTLNLKGAFHIESIK"
     MNGNFAGGYS APDFILARND SELVSAMPQN MAAGYFRTDL MPEVFYHKCA QYTAIKTLAP        60
     ELVFNGRSVN TLTELPRKVV KPMVIRPAFS PQSKGSALIV GGNDRPSMDD VIQQLRHYSG       120
     PFQLHDYEEG QPLFINGILS IGTLIISDMW RCITLPIGYR DILTAVINLS EKALPEGLPQ       180
     QLAELAIGMG MLAGPLHIEL VLTADGPKIV KLTPRLASSP LPDLCHFGGW QSQQQLWQTK       240
     SCNIQHKSLI GYVADYSFIF LQAGRVKQFF FEKEIKALSS FSYYFMSPKI GQDVQMTIDG       300
     DTYGCTLFLR NNSLEILESE IAYLTTLNLK GAFHIESIK                              339
//

If you have problems or comments...

PBIL Back to PBIL home page