(data stored in ACNUC1104 zone)

EMBL: FN667742.PE254

FN667742.PE254       Location/Qualifiers
FT   CDS             228693..228977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88347"
FT                   /db_xref="GOA:D3VH62"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88347.1"
FT                   /translation="MMDSPEKILCKEYGSQGGEDHLVSLNKSIALYKQSKSELYRLFYN
FT                   SLLCLETFEGDMHYAYIRVSSVDQHVEHQKEALSASGFEIDKIYLVLSH"
     MMDSPEKILC KEYGSQGGED HLVSLNKSIA LYKQSKSELY RLFYNSLLCL ETFEGDMHYA        60
     YIRVSSVDQH VEHQKEALSA SGFEIDKIYL VLSH                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page