(data stored in ACNUC1104 zone)

EMBL: FN667742.PE287

FN667742.PE287       Location/Qualifiers
FT   CDS             260001..260408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0298"
FT                   /product="putative Retron-type reverse transcriptase-like"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88380"
FT                   /db_xref="GOA:D3VHP1"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88380.1"
FT                   /translation="MLINDAQVQNNAATGRSSGRYPPGLPGGAEINTSVSGRTKAERPL
FT                   TMETVIERANMMLAYQRVVENKGAAGVDNLSVTELEPWLNTLGDTQNGYPETGRWRENM
FT                   GYPNGGRPAYPTSDSTTVNSSRGIHILQLRL"
     MLINDAQVQN NAATGRSSGR YPPGLPGGAE INTSVSGRTK AERPLTMETV IERANMMLAY        60
     QRVVENKGAA GVDNLSVTEL EPWLNTLGDT QNGYPETGRW RENMGYPNGG RPAYPTSDST       120
     TVNSSRGIHI LQLRL                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page