(data stored in ACNUC1104 zone)

EMBL: FN667742.PE346

FN667742.PE346       Location/Qualifiers
FT   CDS             289847..290221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88439"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88439.1"
FT                   /translation="MEMLLWKRSPCNEKFVSKLVRLGGFHDNWFKKCSFKNKIKKNYCQ
FT                   RRKTPYNAPPLTDAELRHAAEDSRRDSENKRLTPEAKSVRYAASQPGRRFPVAPLFNKL
FT                   IRQSVWALTRHYRTPKGAKD"
     MEMLLWKRSP CNEKFVSKLV RLGGFHDNWF KKCSFKNKIK KNYCQRRKTP YNAPPLTDAE        60
     LRHAAEDSRR DSENKRLTPE AKSVRYAASQ PGRRFPVAPL FNKLIRQSVW ALTRHYRTPK       120
     GAKD                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page