(data stored in ACNUC1104 zone)

EMBL: FN667742.PE38

FN667742.PE38        Location/Qualifiers
FT   CDS             complement(40823..42280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0007"
FT                   /locus_tag="XNC1_0038"
FT                   /product="conserved hypothetical protein; putative von
FT                   Willebrand factor type A (vWA) domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88131"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88131.1"
FT                   /translation="MLTLTTLDLLLSINEGELIEEITLTLLSTPQLLIFFEKFPRIKQA
FT                   LQKDLPAWQQILLQRIKEAQIPAPLAEEFQLYQQVQASNTEDFYQQLPIIVEKLQQIGS
FT                   PFANEANTLLKTISGHTHSEHILFLQHWRINLIRQVTIFNKMLLEQEKEQLLAEIQKRL
FT                   TLIDHLDPVFDHNDRAAGRLWDMSKSQLHLTSQHTQLITLYADFLTHQPELEKLAQLLG
FT                   RSQTAKSIPEESHALQPITRLERIPDTVPEQVSGIRQSNDILRLLPTEIAMLGIEELEY
FT                   EFYRRLAEKKLLSYRLQGDSWQLKTTLKRVTHHHNKEQPKGPFIVCVDTSGSMGGFNEL
FT                   CAKAFCLALMRIALEDNRHCHIMLFSTALIHYELTSPTGLTQAIHFLGQTFRGGTDLAY
FT                   CLSTTVEKMKENIWKDADTVVISDFIAQRLPDTLIHQIKNLQQHQQHRFHAVSLSHYGK
FT                   PGIMRIFDHIWHFDTGFISRLQRKRRN"
     MLTLTTLDLL LSINEGELIE EITLTLLSTP QLLIFFEKFP RIKQALQKDL PAWQQILLQR        60
     IKEAQIPAPL AEEFQLYQQV QASNTEDFYQ QLPIIVEKLQ QIGSPFANEA NTLLKTISGH       120
     THSEHILFLQ HWRINLIRQV TIFNKMLLEQ EKEQLLAEIQ KRLTLIDHLD PVFDHNDRAA       180
     GRLWDMSKSQ LHLTSQHTQL ITLYADFLTH QPELEKLAQL LGRSQTAKSI PEESHALQPI       240
     TRLERIPDTV PEQVSGIRQS NDILRLLPTE IAMLGIEELE YEFYRRLAEK KLLSYRLQGD       300
     SWQLKTTLKR VTHHHNKEQP KGPFIVCVDT SGSMGGFNEL CAKAFCLALM RIALEDNRHC       360
     HIMLFSTALI HYELTSPTGL TQAIHFLGQT FRGGTDLAYC LSTTVEKMKE NIWKDADTVV       420
     ISDFIAQRLP DTLIHQIKNL QQHQQHRFHA VSLSHYGKPG IMRIFDHIWH FDTGFISRLQ       480
     RKRRN                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page