(data stored in ACNUC1104 zone)

EMBL: FN667742.PE394

FN667742.PE394       Location/Qualifiers
FT   CDS             343777..344376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0076"
FT                   /locus_tag="XNC1_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88487"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88487.1"
FT                   /translation="MVERIRVPHPVRESTSLMEWHMNRQRKRICYLEDDLICLVEQAKQ
FT                   NEVLFSHLLQLLSDLSGAKSLQDFLSRLSSWSKTLGLSNSYIRLFSDTWRLGAPMNSPE
FT                   LSLSRYSFEPVRIKRFGDSNHYLGSLHGPEILLLMPQARHVGSVAISLLGTQGNLGMVI
FT                   FNSHDKQHYHDGMGTDLLDQLAKLLPGLLSRWIERA"
     MVERIRVPHP VRESTSLMEW HMNRQRKRIC YLEDDLICLV EQAKQNEVLF SHLLQLLSDL        60
     SGAKSLQDFL SRLSSWSKTL GLSNSYIRLF SDTWRLGAPM NSPELSLSRY SFEPVRIKRF       120
     GDSNHYLGSL HGPEILLLMP QARHVGSVAI SLLGTQGNLG MVIFNSHDKQ HYHDGMGTDL       180
     LDQLAKLLPG LLSRWIERA                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page