(data stored in ACNUC1104 zone)

EMBL: FN667742.PE410

FN667742.PE410       Location/Qualifiers
FT   CDS             356167..356967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0078"
FT                   /locus_tag="XNC1_0426"
FT                   /product="putative hydrolase, contains phosphatase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88503"
FT                   /db_xref="GOA:D3VI14"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88503.1"
FT                   /translation="MYHVVASDLDGTLLSPDHKLTPYTKETLNLLITQGVHFIFATGRH
FT                   HVDVGQIRDGLGIDAYMITSNGARVHNTQNELVFSHNLDPEIAHDLCLLEFDNPEVLTN
FT                   YFNNDDWLMNREAPEQAEFFQESVFHYQLFRRDNFSTDGVCKVYYTSDDHDYLVDLEGR
FT                   IKARWGEKVNVSFSLRNCLEVMSGGVSKGHALEQVCQFLGYQLNDCIAFGDGMNDREML
FT                   SVAGKGCIMQGAHQRLKDILPEMEVIGSNGDDAVSRYLRGMYRV"
     MYHVVASDLD GTLLSPDHKL TPYTKETLNL LITQGVHFIF ATGRHHVDVG QIRDGLGIDA        60
     YMITSNGARV HNTQNELVFS HNLDPEIAHD LCLLEFDNPE VLTNYFNNDD WLMNREAPEQ       120
     AEFFQESVFH YQLFRRDNFS TDGVCKVYYT SDDHDYLVDL EGRIKARWGE KVNVSFSLRN       180
     CLEVMSGGVS KGHALEQVCQ FLGYQLNDCI AFGDGMNDRE MLSVAGKGCI MQGAHQRLKD       240
     ILPEMEVIGS NGDDAVSRYL RGMYRV                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page