(data stored in ACNUC1104 zone)

EMBL: FN667742.PE413

FN667742.PE413       Location/Qualifiers
FT   CDS             360423..360689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0429"
FT                   /product="putative membrane protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88506"
FT                   /db_xref="GOA:D3VI17"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88506.1"
FT                   /translation="MFYLFNLIASVALIILGSIVDENAGIALLAVYSIVTLIPNLAVTV
FT                   RRLHDTNHSGWWLLISIIPFASIVLLVFYCTEGTTGEDPKKVA"
     MFYLFNLIAS VALIILGSIV DENAGIALLA VYSIVTLIPN LAVTVRRLHD TNHSGWWLLI        60
     SIIPFASIVL LVFYCTEGTT GEDPKKVA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page