(data stored in ACNUC1104 zone)

EMBL: FN667742.PE421

FN667742.PE421       Location/Qualifiers
FT   CDS             complement(369191..372571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0438"
FT                   /product="putative oxyreductase protein"
FT                   /EC_number="1.2.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88514"
FT                   /db_xref="GOA:D3VI25"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88514.1"
FT                   /translation="MARYYHSKFVTGTEALVDLLLAQAELDEIYNLNTAGFVSGYRGSP
FT                   LARLDQILWQRSKELIQANIRFQPAINEDLAANALIGTQKVESDPDRQVSGVFGMWYGK
FT                   GPGVDRSGDALRHGNAYGSSPHGGVLVILGDDHGCVSSSLSHQSDLSLMSWSMPVLHPA
FT                   STADYLDVGLWGWAASRVSGAWIGFKAISETVESGAVRENKPFPDYKIPHVDPGPDGLH
FT                   WRWPDLPGPQLEKRLCYKLKAVEDFAGLNPIDCLLSPCKHPQALLVSVGKAHQDVMEVL
FT                   RVGGLTPADLAQQGVALLHVRLVYPLSPLLTELAAQATHIFVIEEKAAVVEILLAHHLV
FT                   KVQKNVRLIGKHNHLGQKLLPADLELRPSRIATPLAEWLQQFNLSLPVPLEWSTSVIPY
FT                   DATLPKRTPYFCAGCPHSTSTKLPEGSHAQIGIGCHIMAAWMDRNTGSGLLPMGGEGID
FT                   WIGHAPFVNRSHVFQNIGDGTYFHSGHLAIRQSVAAGSHITYKLLFNDAVAMTGGQPLD
FT                   GNISIPQIASLMLAEGVKEVAVVTDDLDKYKGKIRLPANVKLYGRDYLEDVQMRFREIV
FT                   GVTVVIYDQACATELRRKRKRGLLPKATHRAIINESVCEGCGDCQIQSNCLAVTPVKTP
FT                   LGTKRRIDQHICNSDLSCLKGFCPSFITVENANPRSDFSKVMSQADLDNIISELPLPTL
FT                   APMETPYEILLVGIGGTGIVTAGHLLANAAQLDNCAVSLLNFTGFAQKGGAAITHVRLC
FT                   HDANKLHQVRIDRGRANLVIAADLVAATGKNSLEVMSRGSTKCLLNTHETQIGAMLRAP
FT                   MLDLDQPNMLNILNQHIQKLRSIDAEMMAAHLVGDRDQINIILIGYAWQLGKLPITLSS
FT                   IDKTIQELGHSADNARRAFHIGRIAAEQPEILLKHLDIDPQETLESLDDLIMNRYQLLV
FT                   DYQNERYAMRYLSRIAQVQMAAQQIDAEELTKSVAKNLFKLMAYKDEYEVARLYVKTDF
FT                   LAKLRSQFDNVDNIRFHLSFPLFNRKNPRTGQRAKREYGSWIIPLFHFLAACKPLRGTV
FT                   FDIFGYQEERKQERNILLEYEQIVDFMINKLDRNNLAICQQLAVLPDQVRGFGHVKQKT
FT                   IENMMERKKNLLKELKKAM"
     MARYYHSKFV TGTEALVDLL LAQAELDEIY NLNTAGFVSG YRGSPLARLD QILWQRSKEL        60
     IQANIRFQPA INEDLAANAL IGTQKVESDP DRQVSGVFGM WYGKGPGVDR SGDALRHGNA       120
     YGSSPHGGVL VILGDDHGCV SSSLSHQSDL SLMSWSMPVL HPASTADYLD VGLWGWAASR       180
     VSGAWIGFKA ISETVESGAV RENKPFPDYK IPHVDPGPDG LHWRWPDLPG PQLEKRLCYK       240
     LKAVEDFAGL NPIDCLLSPC KHPQALLVSV GKAHQDVMEV LRVGGLTPAD LAQQGVALLH       300
     VRLVYPLSPL LTELAAQATH IFVIEEKAAV VEILLAHHLV KVQKNVRLIG KHNHLGQKLL       360
     PADLELRPSR IATPLAEWLQ QFNLSLPVPL EWSTSVIPYD ATLPKRTPYF CAGCPHSTST       420
     KLPEGSHAQI GIGCHIMAAW MDRNTGSGLL PMGGEGIDWI GHAPFVNRSH VFQNIGDGTY       480
     FHSGHLAIRQ SVAAGSHITY KLLFNDAVAM TGGQPLDGNI SIPQIASLML AEGVKEVAVV       540
     TDDLDKYKGK IRLPANVKLY GRDYLEDVQM RFREIVGVTV VIYDQACATE LRRKRKRGLL       600
     PKATHRAIIN ESVCEGCGDC QIQSNCLAVT PVKTPLGTKR RIDQHICNSD LSCLKGFCPS       660
     FITVENANPR SDFSKVMSQA DLDNIISELP LPTLAPMETP YEILLVGIGG TGIVTAGHLL       720
     ANAAQLDNCA VSLLNFTGFA QKGGAAITHV RLCHDANKLH QVRIDRGRAN LVIAADLVAA       780
     TGKNSLEVMS RGSTKCLLNT HETQIGAMLR APMLDLDQPN MLNILNQHIQ KLRSIDAEMM       840
     AAHLVGDRDQ INIILIGYAW QLGKLPITLS SIDKTIQELG HSADNARRAF HIGRIAAEQP       900
     EILLKHLDID PQETLESLDD LIMNRYQLLV DYQNERYAMR YLSRIAQVQM AAQQIDAEEL       960
     TKSVAKNLFK LMAYKDEYEV ARLYVKTDFL AKLRSQFDNV DNIRFHLSFP LFNRKNPRTG      1020
     QRAKREYGSW IIPLFHFLAA CKPLRGTVFD IFGYQEERKQ ERNILLEYEQ IVDFMINKLD      1080
     RNNLAICQQL AVLPDQVRGF GHVKQKTIEN MMERKKNLLK ELKKAM                     1126
//

If you have problems or comments...

PBIL Back to PBIL home page