(data stored in ACNUC1104 zone)

EMBL: FN667742.PE426

FN667742.PE426       Location/Qualifiers
FT   CDS             378057..379274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0081"
FT                   /locus_tag="XNC1_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88519"
FT                   /db_xref="GOA:D3VI30"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88519.1"
FT                   /translation="MQTTMYSEWGKNSNVIPTSADQFHQMALNIRRVLREKQDEHNKLG
FT                   TYALGLHEWFLKQGFYRLLQPKKYGGFEFSFSEYYRIMLAISEGHPSLGWGLTLGASHV
FT                   FLIASHWPESVQNELLNGNEQFIAAHKAFPAGTCKRVSQGYIVDGIFSYCSGITYASHV
FT                   ILSVMCDSQYPINCIIPKQDFEILNDWGEQRTLGMWASGSNSIRLNSVFVPERMVSPFR
FT                   AFYADQNVDHGTEGTRVHNNSMYLGYLMAPYHANLLVPIIGASKAALEEFRKYEKPGDI
FT                   NEMMFIRALGLATLLSDSAEAILFNVFDKYSSFCQRWEEHRLPMTVDENLRLWGLLQQA
FT                   GRLASESIDTLFRNAGSSAALKGSRLLQYFNDTQMYRGHVGSQWEQLSLYVGRSILNRK
FT                   ISFLDL"
     MQTTMYSEWG KNSNVIPTSA DQFHQMALNI RRVLREKQDE HNKLGTYALG LHEWFLKQGF        60
     YRLLQPKKYG GFEFSFSEYY RIMLAISEGH PSLGWGLTLG ASHVFLIASH WPESVQNELL       120
     NGNEQFIAAH KAFPAGTCKR VSQGYIVDGI FSYCSGITYA SHVILSVMCD SQYPINCIIP       180
     KQDFEILNDW GEQRTLGMWA SGSNSIRLNS VFVPERMVSP FRAFYADQNV DHGTEGTRVH       240
     NNSMYLGYLM APYHANLLVP IIGASKAALE EFRKYEKPGD INEMMFIRAL GLATLLSDSA       300
     EAILFNVFDK YSSFCQRWEE HRLPMTVDEN LRLWGLLQQA GRLASESIDT LFRNAGSSAA       360
     LKGSRLLQYF NDTQMYRGHV GSQWEQLSLY VGRSILNRKI SFLDL                       405
//

If you have problems or comments...

PBIL Back to PBIL home page