(data stored in ACNUC1104 zone)

EMBL: FN667742.PE453

FN667742.PE453       Location/Qualifiers
FT   CDS             403486..403815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0087"
FT                   /locus_tag="XNC1_0472"
FT                   /product="PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88546"
FT                   /db_xref="GOA:D3VIJ6"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88546.1"
FT                   /translation="MYIPDKGDIVSLNFDPSAGKEIMKRRPVFVISRKMFNERTGFAVV
FT                   VPITSTARGMKLEVVLPEEVSVQGSILIHQVKSLDFSERQVKFIEKAPQYIIDRVTELT
FT                   KAIIL"
     MYIPDKGDIV SLNFDPSAGK EIMKRRPVFV ISRKMFNERT GFAVVVPITS TARGMKLEVV        60
     LPEEVSVQGS ILIHQVKSLD FSERQVKFIE KAPQYIIDRV TELTKAIIL                   109
//

If you have problems or comments...

PBIL Back to PBIL home page