(data stored in ACNUC1104 zone)

EMBL: FN667742.PE455

FN667742.PE455       Location/Qualifiers
FT   CDS             complement(404820..405377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0474"
FT                   /product="Protein ytfJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88548"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88548.1"
FT                   /translation="MLKNIMLSSILSLMPIFAFAHNITLEQHVPAVSVTDKGELLLNEG
FT                   KFSYQSWSSAELPGKVRTIQHIAGRSSAKEMNDPLIQALKDADLPKDKYQTTSIVNTDD
FT                   AIFGTSVFVRNSLEDSKKQFPWSQFIVDSNGVAKNAWGLEPKSSAIIVLDKKGNVKFVK
FT                   DGKLSSEEIAHVISIIEDELKK"
     MLKNIMLSSI LSLMPIFAFA HNITLEQHVP AVSVTDKGEL LLNEGKFSYQ SWSSAELPGK        60
     VRTIQHIAGR SSAKEMNDPL IQALKDADLP KDKYQTTSIV NTDDAIFGTS VFVRNSLEDS       120
     KKQFPWSQFI VDSNGVAKNA WGLEPKSSAI IVLDKKGNVK FVKDGKLSSE EIAHVISIIE       180
     DELKK                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page