(data stored in ACNUC1104 zone)

EMBL: FN667742.PE468

FN667742.PE468       Location/Qualifiers
FT   CDS             420389..420736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0090"
FT                   /locus_tag="XNC1_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88561"
FT                   /db_xref="GOA:D3VIL1"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88561.1"
FT                   /translation="MKKEWYTAMELTGVGELPRSPQGVNARAKREEWLRQKRTGVQGRA
FT                   IEYHYSCFPESTLTVLELNETSPEYQVQKQDPLSIWVSAFNLLTEEEKEVITEVILRDG
FT                   IRSFLEKITAT"
     MKKEWYTAME LTGVGELPRS PQGVNARAKR EEWLRQKRTG VQGRAIEYHY SCFPESTLTV        60
     LELNETSPEY QVQKQDPLSI WVSAFNLLTE EEKEVITEVI LRDGIRSFLE KITAT            115
//

If you have problems or comments...

PBIL Back to PBIL home page