(data stored in ACNUC1104 zone)

EMBL: FN667742.PE484

FN667742.PE484       Location/Qualifiers
FT   CDS             433136..433558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0094"
FT                   /locus_tag="XNC1_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88577"
FT                   /db_xref="GOA:D3VIM7"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88577.1"
FT                   /translation="MISAPVEALGFELVGLEFIRARVSTLRVYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVLYNLEISSPGLERPLFTAEHYQRFIGEEVNVVLRMAMQNRRRWQ
FT                   GIIKAVDGEMITVTVDGKDEVFALSNIQKANLVPHF"
     MISAPVEALG FELVGLEFIR ARVSTLRVYI DSEEGITVDN CADVSHQVSA VLDVEDPISV        60
     LYNLEISSPG LERPLFTAEH YQRFIGEEVN VVLRMAMQNR RRWQGIIKAV DGEMITVTVD       120
     GKDEVFALSN IQKANLVPHF                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page