(data stored in ACNUC1104 zone)

EMBL: FN667742.PE496

FN667742.PE496       Location/Qualifiers
FT   CDS             452552..452809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0097"
FT                   /locus_tag="XNC1_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88589"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88589.1"
FT                   /translation="MGDLLSILDVESGNAAGSWLTLFFQRRLRIEGNTELGLHVKNLLD
FT                   STELESMPSILRFGLLRLAEFIKAGQKEGVDQHDRALSPC"
     MGDLLSILDV ESGNAAGSWL TLFFQRRLRI EGNTELGLHV KNLLDSTELE SMPSILRFGL        60
     LRLAEFIKAG QKEGVDQHDR ALSPC                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page