(data stored in ACNUC1104 zone)

EMBL: FN667742.PE498

FN667742.PE498       Location/Qualifiers
FT   CDS             complement(453344..453655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88591"
FT                   /db_xref="GOA:D3VIP1"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR022992"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88591.1"
FT                   /translation="MTESSWYLYLIRAQNGALYTGITTDVSRRLMQHTSGKGAKALRGK
FT                   GPLILVYQGLVKDRGTALKAEYRVKRLSKQQKERLIMIQPLCITTYLVTIGFSETFFT"
     MTESSWYLYL IRAQNGALYT GITTDVSRRL MQHTSGKGAK ALRGKGPLIL VYQGLVKDRG        60
     TALKAEYRVK RLSKQQKERL IMIQPLCITT YLVTIGFSET FFT                         103
//

If you have problems or comments...

PBIL Back to PBIL home page