(data stored in ACNUC1104 zone)

EMBL: FN667742.PE50

FN667742.PE50        Location/Qualifiers
FT   CDS             58936..59604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88143"
FT                   /db_xref="GOA:D3VG53"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88143.1"
FT                   /translation="MNGLQVYRGKIISSEKWGPSAVNKLLVNGRLQLTSLGLEGDEQAE
FT                   GFHGGPDRALCHYPREHYLFWKRQFPELMETFVSPLFGENLSTEGMTEDNVYIGDIFQW
FT                   GEALIQITQPRSPCYKLNLITGISDFSAMMQNNGCCGWLYRVISAGFVSTGEPIKLLSR
FT                   NSDVSVTEAISIAFHSPFDEEQYRRLMGVAGLSASWNLTMQKRITHGKIEDFNRRLFGH
FT                   "
     MNGLQVYRGK IISSEKWGPS AVNKLLVNGR LQLTSLGLEG DEQAEGFHGG PDRALCHYPR        60
     EHYLFWKRQF PELMETFVSP LFGENLSTEG MTEDNVYIGD IFQWGEALIQ ITQPRSPCYK       120
     LNLITGISDF SAMMQNNGCC GWLYRVISAG FVSTGEPIKL LSRNSDVSVT EAISIAFHSP       180
     FDEEQYRRLM GVAGLSASWN LTMQKRITHG KIEDFNRRLF GH                          222
//

If you have problems or comments...

PBIL Back to PBIL home page