(data stored in ACNUC1104 zone)

EMBL: FN667742.PE511

FN667742.PE511       Location/Qualifiers
FT   CDS             463944..464216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0101"
FT                   /locus_tag="XNC1_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88604"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88604.1"
FT                   /translation="MAITRLRQQGGAVVVTIPSDVATVMGWSVGMQLDIKSSGDTISIK
FT                   PVERIARGRKSLSELLQSIDETEVRAFNEATAGDLNSPPVGNEVI"
     MAITRLRQQG GAVVVTIPSD VATVMGWSVG MQLDIKSSGD TISIKPVERI ARGRKSLSEL        60
     LQSIDETEVR AFNEATAGDL NSPPVGNEVI                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page