(data stored in ACNUC1104 zone)

EMBL: FN667742.PE512

FN667742.PE512       Location/Qualifiers
FT   CDS             complement(463964..464341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88605"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88605.1"
FT                   /translation="MIQCKFRDNQIIIGPFELSAANRIAVSVPDFTLAWDVPSTHHQIT
FT                   SLPTGGEFKSPAVASLKARTSVSSMLCNSSESDFLPLAILSTGLMLIVSPDDFISNCIP
FT                   TDHPITVATSLGIVTTTAPPC"
     MIQCKFRDNQ IIIGPFELSA ANRIAVSVPD FTLAWDVPST HHQITSLPTG GEFKSPAVAS        60
     LKARTSVSSM LCNSSESDFL PLAILSTGLM LIVSPDDFIS NCIPTDHPIT VATSLGIVTT       120
     TAPPC                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page