(data stored in ACNUC1104 zone)

EMBL: FN667742.PE517

FN667742.PE517       Location/Qualifiers
FT   CDS             complement(466590..466757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0102"
FT                   /locus_tag="XNC1_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88610"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88610.1"
FT                   /translation="MNTIVSIMRDDLLGENMKDDAVKAVKHQPNENLSAGSVGVLFFPL
FT                   LNRTFKKPLN"
     MNTIVSIMRD DLLGENMKDD AVKAVKHQPN ENLSAGSVGV LFFPLLNRTF KKPLN             55
//

If you have problems or comments...

PBIL Back to PBIL home page